PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000835180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 489aa    MW: 54005.8 Da    PI: 4.4169
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000835180genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM108.48.6e-34231474127
            NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     +rFhPt+ee+  ++L kk++g++ ++ + ++ +d++k+ePwdLp+     ++ + k wy Fs+ d ky ++ r nr+t++g+Wk tgk +++ s 
  MDP0000835180  23 AIRFHPTEEEMA-DFLWKKMKGHNSQACHSLPVIDVCKFEPWDLPErmfpDTRYQAKAWYSFSQPDYKYINSPRCNRITEKGFWKITGKPRDISS- 116
                    58********99.9**********999899**************9546664455788************************************99. PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                     ++++  k+tL+fykgr +k+e+t Wvmhey 
  MDP0000835180 117 -THVTCKKRTLTFYKGRVSKSERTGWVMHEYY 147
                    .77888999**********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-3513175IPR003441NAC domain
PROSITE profilePS5100535.09820175IPR003441NAC domain
PfamPF023652.0E-1424146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MGNISSSTAT STTGQSVPDM VLAIRFHPTE EEMADFLWKK MKGHNSQACH SLPVIDVCKF  60
EPWDLPERMF PDTRYQAKAW YSFSQPDYKY INSPRCNRIT EKGFWKITGK PRDISSTHVT  120
CKKRTLTFYK GRVSKSERTG WVMHEYYFTK PKQGSNTSQG RDPLRDFVLY RLKKKPANSM  180
SDNKNLQDTL IGDDLTDPGN GSCIASSSGN DQAATAAALN HDMTPAAEEL LAXQELEDDL  240
FDSGNHDRGE PGGGISSDST DQVLRDMIQQ PPQPPQLGNA PDVCSDEFVD PSTGGCITCN  300
TDNQDAAMNH MISAEEEILA YKQLERALLG NGDHDDGEPG SGGSSDFNDQ AVDDMILELS  360
AELQKDSDSP FPPXEPSQTI QPHQLGDAAD VHSGKFSNCP SPTNYDNESV INIVYNSQNR  420
ATSERISEAY SQREENRESP FQPFDHYPLQ SPLFSSELGE LMLANTYIGG NESQSLNIEP  480
ATLFPQSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-232317920169NO APICAL MERISTEM PROTEIN
1ut4_B7e-232317920169NO APICAL MERISTEM PROTEIN
1ut7_A7e-232317920169NO APICAL MERISTEM PROTEIN
1ut7_B7e-232317920169NO APICAL MERISTEM PROTEIN
3swm_A1e-222317923172NAC domain-containing protein 19
3swm_B1e-222317923172NAC domain-containing protein 19
3swm_C1e-222317923172NAC domain-containing protein 19
3swm_D1e-222317923172NAC domain-containing protein 19
3swp_A1e-222317923172NAC domain-containing protein 19
3swp_B1e-222317923172NAC domain-containing protein 19
3swp_C1e-222317923172NAC domain-containing protein 19
3swp_D1e-222317923172NAC domain-containing protein 19
4dul_A7e-232317920169NAC domain-containing protein 19
4dul_B7e-232317920169NAC domain-containing protein 19
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.85101e-68fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376032.10.0PREDICTED: uncharacterized protein LOC103964786 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1887626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.33e-30NAC transcription factor-like 9